PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi2g25090.1.p
Common NameLOC100832541, MADS4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MIKC_MADS
Protein Properties Length: 244aa    MW: 27455.9 Da    PI: 9.3909
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi2g25090.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF95.22.8e-30959151
                      S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
            SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                      krien++ rqvtf+kRrng+lKKA+ELSvLCdae+a+i+fss+g+lyey+s
  Bradi2g25090.1.p  9 KRIENTTSRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRLYEYAS 59
                      79***********************************************86 PP

2K-box1072.1e-35831749100
             K-box   9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100
                       ++ + +++ qqe+akL+++i++Lq+ +Rhl+Ge+++sL+lkeL++Le++Lek++ +iRskK+elll++ie++qk+e +lq+en++Lr+k++e
  Bradi2g25090.1.p  83 VDVNSQQYFQQESAKLRNQIQSLQSANRHLVGESVGSLTLKELKSLENRLEKGIGRIRSKKHELLLAEIEYMQKMEADLQSENMYLRAKMAE 174
                       667788***********************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006633.922161IPR002100Transcription factor, MADS-box
SMARTSM004321.5E-42160IPR002100Transcription factor, MADS-box
CDDcd002651.40E-46275No hitNo description
SuperFamilySSF554558.37E-33274IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-32323IPR002100Transcription factor, MADS-box
PfamPF003193.8E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-322338IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-323859IPR002100Transcription factor, MADS-box
PfamPF014868.1E-2885172IPR002487Transcription factor, K-box
PROSITE profilePS5129715.10688178IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048438Biological Processfloral whorl development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 244 aa     Download sequence    Send to blast
MGRGKIEIKR IENTTSRQVT FCKRRNGLLK KAYELSVLCD AEIALIVFSS RGRLYEYASN  60
STRSTIDRYK KASASPSGSA PTVDVNSQQY FQQESAKLRN QIQSLQSANR HLVGESVGSL  120
TLKELKSLEN RLEKGIGRIR SKKHELLLAE IEYMQKMEAD LQSENMYLRA KMAEAERVAA  180
TELDALPTFD ARSYYQHQQL QVNMQLHEEA ASSSRYSSQP QHQDQATATT TALHLGYEMT  240
GPN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S5e-22185184Myocyte-specific enhancer factor 2B
1tqe_R5e-22185184Myocyte-specific enhancer factor 2B
1tqe_Q5e-22185184Myocyte-specific enhancer factor 2B
1tqe_P5e-22185184Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ5883230.0HQ588323.1 Brachypodium distachyon MADS-box (MADS4) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001266821.10.0uncharacterized protein LOC100832541
RefseqXP_010230319.10.0PREDICTED: uncharacterized protein LOC100832541 isoform X1
SwissprotQ8RU311e-115MAD21_ORYSJ; MADS-box transcription factor 21
TrEMBLG9BIK90.0G9BIK9_BRADI; MADS-box
STRINGBRADI2G25090.11e-180(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64937144
Representative plantOGRP1617761
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G09960.19e-90MIKC_MADS family protein